SCOPe 2.07: Domain d6cf7b_: 6cf7 B:

Lineage for d6cf7b_ (6cf7 B:)

1. Root: SCOPe 2.07

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein Influenza hemagglutinin (stalk) [58066] (17 species)
   trimer

7. Species Influenza A virus, different strains [TaxId:11320] [58067] (131 PDB entries)

8. Domain d6cf7b_: 6cf7 B: [364853]
   Other proteins in same PDB: d6cf7a_
   automated match to d1rd8b_
   complexed with bma, ez7, man, nag

Details for d6cf7b_

PDB Entry: 6cf7, 2.72 Å

PDB Description: crystal structure of the a/solomon islands/3/2006(h1n1) influenza virus hemagglutinin in complex with small molecule jnj4796

PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d6cf7b_:

Sequence; same for both SEQRES and ATOM records:

>d6cf7b_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
tqftavgkefnklerrmenlnkkvddgfidiwtynaellvllenertldfhdsnvknlye
kvksqlknnakeigngcfefyhkcndecmesvkngtydypkyseesklnre

Timeline for d6cf7b_:

• d6cf7b_ is new in SCOPe 2.07-stable
  
• d6cf7b_ appears in the current release, SCOPe 2.08