Lineage for d6e5wc_ (6e5w C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2805574Family b.60.1.0: automated matches [191454] (1 protein)
    not a true family
  6. 2805575Protein automated matches [190698] (25 species)
    not a true protein
  7. 2805614Species Human (Homo sapiens) [TaxId:9606] [187833] (51 PDB entries)
  8. 2805689Domain d6e5wc_: 6e5w C: [364836]
    automated match to d1kgla_
    complexed with gol, hvd

Details for d6e5wc_

PDB Entry: 6e5w (more details), 2.5 Å

PDB Description: crystal structure of human cellular retinol binding protein 3 in complex with abnormal-cannabidiol (abn-cbd)
PDB Compounds: (C:) Retinol-binding protein 5

SCOPe Domain Sequences for d6e5wc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6e5wc_ b.60.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pnltgyyrfvsqknmedylqalnislavrkialllkpdkeiehqgnhmtvrtlstfrnyt
vqfdvgvefeedlrsvdgrkcqtivtweeehlvcvqkgevpnrgwrhwlegemlylelta
rdavceqvfrkvr

SCOPe Domain Coordinates for d6e5wc_:

Click to download the PDB-style file with coordinates for d6e5wc_.
(The format of our PDB-style files is described here.)

Timeline for d6e5wc_: