Class b: All beta proteins [48724] (180 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
Protein automated matches [190824] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188940] (31 PDB entries) |
Domain d6ce1a1: 6ce1 A:2-114 [364833] Other proteins in same PDB: d6ce1a2, d6ce1a3 automated match to d2dexx2 |
PDB Entry: 6ce1 (more details), 2.8 Å
SCOPe Domain Sequences for d6ce1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ce1a1 b.6.1.0 (A:2-114) automated matches {Human (Homo sapiens) [TaxId: 9606]} slqrivrvslehptsavcvagvetlvdiygsvpegtemfevygtpgvdiyispnmergre radtrrwrfdatleiivvmnspsndlndshvqisyhssheplplayavlyltc
Timeline for d6ce1a1: