Lineage for d6i8sa_ (6i8s A:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2568174Fold e.1: Serpins [56573] (1 superfamily)
    contains a cluster of helices and a beta-sandwich
  4. 2568175Superfamily e.1.1: Serpins [56574] (2 families) (S)
  5. 2568176Family e.1.1.1: Serpins [56575] (17 proteins)
    automatically mapped to Pfam PF00079
  6. 2568293Protein Plasminogen activator inhibitor-1 [56587] (3 species)
  7. 2568294Species Human (Homo sapiens) [TaxId:9606] [56588] (16 PDB entries)
  8. 3064766Domain d6i8sa_: 6i8s A: [364828]
    Other proteins in same PDB: d6i8si1, d6i8si2, d6i8sj1, d6i8sj2, d6i8sk1, d6i8sk2, d6i8sl1, d6i8sl2
    automated match to d1oc0a_

Details for d6i8sa_

PDB Entry: 6i8s (more details), 2.9 Å

PDB Description: discovery and characterisation of an antibody that selectively modulates the inhibitory activity of plasminogen activator inhibitor- 1
PDB Compounds: (A:) Plasminogen activator inhibitor 1

SCOPe Domain Sequences for d6i8sa_:

Sequence, based on SEQRES records: (download)

>d6i8sa_ e.1.1.1 (A:) Plasminogen activator inhibitor-1 {Human (Homo sapiens) [TaxId: 9606]}
syvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaamgfk
iddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstvkqvd
fseverarfiindwvkthtkgmishllgtgavdqltrlvlvnalyfngqwktpfpdssth
rrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapyekev
plsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrqfqad
ftslsdqeplhvalalqkvkievnesgtvassstavivsarmapeeiiidrpflfvvrhn
ptgtvlfmgqvmep

Sequence, based on observed residues (ATOM records): (download)

>d6i8sa_ e.1.1.1 (A:) Plasminogen activator inhibitor-1 {Human (Homo sapiens) [TaxId: 9606]}
syvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaamgfk
iddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstvkqvd
fseverarfiindwvkthtkgmishllgtgavdqltrlvlvnalyfngqwktpfpdssth
rrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapyekev
plsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrqfqad
ftslsdqeplhvalalqkvkievnesgtarmapeeiiidrpflfvvrhnptgtvlfmgqv
mep

SCOPe Domain Coordinates for d6i8sa_:

Click to download the PDB-style file with coordinates for d6i8sa_.
(The format of our PDB-style files is described here.)

Timeline for d6i8sa_:

  • d6i8sa_ appears in periodic updates to SCOPe 2.07 starting on 2019-02-14