Lineage for d6ec6b3 (6ec6 B:279-600)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2416558Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2418840Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2418841Protein automated matches [190075] (103 species)
    not a true protein
  7. 3061187Species Ruminococcus gnavus [TaxId:33038] [361249] (2 PDB entries)
  8. 3064736Domain d6ec6b3: 6ec6 B:279-600 [364798]
    Other proteins in same PDB: d6ec6a1, d6ec6a2, d6ec6b1, d6ec6b2
    automated match to d5c70a3
    complexed with cl, gol

Details for d6ec6b3

PDB Entry: 6ec6 (more details), 2.85 Å

PDB Description: ruminococcus gnavus beta-glucuronidase
PDB Compounds: (B:) beta-glucuronidase

SCOPe Domain Sequences for d6ec6b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ec6b3 c.1.8.0 (B:279-600) automated matches {Ruminococcus gnavus [TaxId: 33038]}
vriegtqillndrpvylkgfgkhedfsilgrgfhwgivkrdfeclkwtnancfrtshypy
aeewyqfadeegfliidevpavgmmrstrnfvaagsgnytyffealtvpellkshiadte
emitrdknhpsviawslfnepetitdyayeyfkevfaaaetydfqsrpmtgafeknskpe
lckcyplcdficlnryygwyisggpeieeaeelfrdemdrwkakelnvpfvftefgtdtm
aglhklpsimwseeyqkeylemnfrvfdsyefvqgelawnfadfqttegimrvdgnhkgv
ftrdrqpkaaavvfkdrwekkn

SCOPe Domain Coordinates for d6ec6b3:

Click to download the PDB-style file with coordinates for d6ec6b3.
(The format of our PDB-style files is described here.)

Timeline for d6ec6b3:

  • d6ec6b3 appears in periodic updates to SCOPe 2.07 starting on 2019-02-14