Lineage for d6ec6b1 (6ec6 B:1-185)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2369590Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2369591Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2370433Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2370434Protein automated matches [190770] (43 species)
    not a true protein
  7. 3061183Species Ruminococcus gnavus [TaxId:33038] [361245] (2 PDB entries)
  8. 3064734Domain d6ec6b1: 6ec6 B:1-185 [364796]
    Other proteins in same PDB: d6ec6a2, d6ec6a3, d6ec6b2, d6ec6b3
    automated match to d5c70a1
    complexed with cl, gol

Details for d6ec6b1

PDB Entry: 6ec6 (more details), 2.85 Å

PDB Description: ruminococcus gnavus beta-glucuronidase
PDB Compounds: (B:) beta-glucuronidase

SCOPe Domain Sequences for d6ec6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ec6b1 b.18.1.0 (B:1-185) automated matches {Ruminococcus gnavus [TaxId: 33038]}
mleyselypiqnghrmmqsldgmwkfqfdpeeigeksgwenglpapvsmpvpssfadfft
dhkerdycgdfwyetefylpaewrnkkiwlrfgsithrgtvycngmeitsheggflpvla
distvakpgqvnqvvvkinnelnetslpcgatkilnngrklakpyfdffnysglqrsvwv
ialpe

SCOPe Domain Coordinates for d6ec6b1:

Click to download the PDB-style file with coordinates for d6ec6b1.
(The format of our PDB-style files is described here.)

Timeline for d6ec6b1:

  • d6ec6b1 appears in periodic updates to SCOPe 2.07 starting on 2019-02-14