Lineage for d5ze9e3 (5ze9 E:352-455)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325855Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 2325856Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (3 families) (S)
  5. 2326080Family a.69.1.0: automated matches [254233] (1 protein)
    not a true family
  6. 2326081Protein automated matches [254528] (12 species)
    not a true protein
  7. 2326157Species Enterococcus hirae [TaxId:768486] [324662] (3 PDB entries)
  8. 3064709Domain d5ze9e3: 5ze9 E:352-455 [364771]
    Other proteins in same PDB: d5ze9d1, d5ze9d2, d5ze9e1, d5ze9e2, d5ze9f1, d5ze9f2, d5ze9f4
    automated match to d3vr2d3
    complexed with anp, gol, mes, mg; mutant

Details for d5ze9e3

PDB Entry: 5ze9 (more details), 2.1 Å

PDB Description: crystal structure of amp-pnp bound mutant a3b3 complex from enterococcus hirae v-atpase
PDB Compounds: (E:) V-type sodium ATPase subunit B

SCOPe Domain Sequences for d5ze9e3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ze9e3 a.69.1.0 (E:352-455) automated matches {Enterococcus hirae [TaxId: 768486]}
kdkgtgagktredhaatmnqlfaayaqgkqakelavvlgesalsdidkiyakfaerfene
yvnqgfytnrtitetldlgwellamlprtelkrikddlldkylp

SCOPe Domain Coordinates for d5ze9e3:

Click to download the PDB-style file with coordinates for d5ze9e3.
(The format of our PDB-style files is described here.)

Timeline for d5ze9e3:

  • d5ze9e3 appears in periodic updates to SCOPe 2.07 starting on 2019-02-11