SCOPe 2.08: Domain d5ze9e3: 5ze9 E:352-455

Lineage for d5ze9e3 (5ze9 E:352-455)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families)

5. Family a.69.1.0: automated matches [254233] (1 protein)
   not a true family

6. Protein automated matches [254528] (17 species)
   not a true protein

7. Species Enterococcus hirae [TaxId:768486] [324662] (7 PDB entries)

8. Domain d5ze9e3: 5ze9 E:352-455 [364771]
   Other proteins in same PDB: d5ze9d1, d5ze9d2, d5ze9e1, d5ze9e2, d5ze9f1, d5ze9f2, d5ze9f4
   automated match to d3vr2d3
   complexed with anp, gol, mes, mg; mutant

Details for d5ze9e3

PDB Entry: 5ze9, 2.1 Å

PDB Description: crystal structure of amp-pnp bound mutant a3b3 complex from enterococcus hirae v-atpase

PDB Compounds: (E:) V-type sodium ATPase subunit B

SCOPe Domain Sequences for d5ze9e3:

Sequence; same for both SEQRES and ATOM records:

>d5ze9e3 a.69.1.0 (E:352-455) automated matches {Enterococcus hirae [TaxId: 768486]}
kdkgtgagktredhaatmnqlfaayaqgkqakelavvlgesalsdidkiyakfaerfene
yvnqgfytnrtitetldlgwellamlprtelkrikddlldkylp

Timeline for d5ze9e3:

• d5ze9e3 first appeared in SCOPe 2.07