Lineage for d5ze9e2 (5ze9 E:76-351)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2451887Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2451888Protein automated matches [190123] (144 species)
    not a true protein
  7. 2452148Species Enterococcus hirae [TaxId:768486] [324660] (3 PDB entries)
  8. 3064708Domain d5ze9e2: 5ze9 E:76-351 [364770]
    Other proteins in same PDB: d5ze9d1, d5ze9d3, d5ze9e1, d5ze9e3, d5ze9f1, d5ze9f3, d5ze9f4
    automated match to d3vr4d2
    complexed with anp, gol, mes, mg; mutant

Details for d5ze9e2

PDB Entry: 5ze9 (more details), 2.1 Å

PDB Description: crystal structure of amp-pnp bound mutant a3b3 complex from enterococcus hirae v-atpase
PDB Compounds: (E:) V-type sodium ATPase subunit B

SCOPe Domain Sequences for d5ze9e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ze9e2 c.37.1.0 (E:76-351) automated matches {Enterococcus hirae [TaxId: 768486]}
plqlgvsedmigrvfdglgrpkdngpeilpekyldingevinpiardypdefiqtgisai
dhlntlvrgqklpvfsgsglphkelaaqiarqatvldssddfavvfaaigitfeeaeffm
edfrqtgaidrsvmfmnlandpaieriatprmaltaaeylayekgmhvlvimtdmtnyae
alreisaarrevpgrrgypgylytnlatlferagrirglkgsvtqipiltmpeddkthpi
pdltgyitegqiiltrelyksgiqppidvlpslsrl

SCOPe Domain Coordinates for d5ze9e2:

Click to download the PDB-style file with coordinates for d5ze9e2.
(The format of our PDB-style files is described here.)

Timeline for d5ze9e2:

  • d5ze9e2 appears in periodic updates to SCOPe 2.07 starting on 2019-02-11