Lineage for d1gbya_ (1gby A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1887016Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1887017Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1887055Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
    automatically mapped to Pfam PF00062
  6. 1887115Protein Lysozyme [53961] (14 species)
    ubiquitous in a variety of tissues and secretions
  7. 1887828Species Human (Homo sapiens) [TaxId:9606] [53969] (201 PDB entries)
    Uniprot P00695
  8. 1887886Domain d1gbya_: 1gby A: [36476]
    complexed with na; mutant

Details for d1gbya_

PDB Entry: 1gby (more details), 1.8 Å

PDB Description: crystal structure of mutant human lysozyme substituted at the surface positions
PDB Compounds: (A:) lysozyme

SCOPe Domain Sequences for d1gbya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gbya_ d.2.1.2 (A:) Lysozyme {Human (Homo sapiens) [TaxId: 9606]}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawmawrnrcqnrd
vrqyvqgcgv

SCOPe Domain Coordinates for d1gbya_:

Click to download the PDB-style file with coordinates for d1gbya_.
(The format of our PDB-style files is described here.)

Timeline for d1gbya_: