SCOPe 2.07: Domain d5z9rb_: 5z9r B:

Lineage for d5z9rb_ (5z9r B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.0: automated matches [191377] (1 protein)
   not a true family

6. Protein automated matches [190459] (59 species)
   not a true protein

7. Species Mus musculus [TaxId:10090] [364758] (1 PDB entry)

8. Domain d5z9rb_: 5z9r B: [364759]
   automated match to d1gzua_

Details for d5z9rb_

PDB Entry: 5z9r, 2 Å

PDB Description: nmnat as a specific chaperone antagonizing pathological condensation of phosphorylated tau

PDB Compounds: (B:) Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 3

SCOPe Domain Sequences for d5z9rb_:

Sequence, based on SEQRES records:

>d5z9rb_ c.26.1.0 (B:) automated matches {Mus musculus [TaxId: 10090]}
ripvvllacgsfnpitnmhlrlfevardhlhqtgryqviegiispvndsygkkdlvashh
rvamarlalqtsdwirvdpweseqaqwmetvkvlrhhhrellrssaqmdgpdpsktpsas
aalpelkllcgadvlktfqtpnlwkdthiqeivekfglvcvsrsghdperyisdspilqq
fqhnihlarepvlneisatyvrkalgqgqsvkyllpeavityirdqglyin

Sequence, based on observed residues (ATOM records):

>d5z9rb_ c.26.1.0 (B:) automated matches {Mus musculus [TaxId: 10090]}
ripvvllacgsfnpitnmhlrlfevardhlhqtgryqviegiispvndsygkkdlvashh
rvamarlalqtsdwirvdpweseqaqwmetvkvlrhhhrellrssaqmalpelkllcgad
vlktfqtpnlwkdthiqeivekfglvcvsrsghdperyisdspilqqfqhnihlarepvl
neisatyvrkalgqgqsvkyllpeavityirdqglyin

Timeline for d5z9rb_:

• d5z9rb_ is new in SCOPe 2.07-stable
  
• d5z9rb_ appears in the current release, SCOPe 2.08