Class b: All beta proteins [48724] (180 folds) |
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies) barrel, closed; n=6, S=8; greek-key Many cradle-loop superfamilies may be homologous, according to PubMed 18457946 |
Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) automatically mapped to Pfam PF02874 |
Family b.49.1.0: automated matches [254232] (1 protein) not a true family |
Protein automated matches [254527] (17 species) not a true protein |
Species Enterococcus hirae [TaxId:768486] [324658] (7 PDB entries) |
Domain d5ze9f1: 5ze9 F:1-75 [364745] Other proteins in same PDB: d5ze9d2, d5ze9d3, d5ze9e2, d5ze9e3, d5ze9f2, d5ze9f3, d5ze9f4 automated match to d3vr2d1 complexed with anp, gol, mes, mg; mutant |
PDB Entry: 5ze9 (more details), 2.1 Å
SCOPe Domain Sequences for d5ze9f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ze9f1 b.49.1.0 (F:1-75) automated matches {Enterococcus hirae [TaxId: 768486]} mikeyrtikevvgplmavekvsgvkyeelievrmqngeirrgqvlevqedkamvqifegt sginyknssvrflgh
Timeline for d5ze9f1: