Lineage for d2xaub3 (2xau B:455-520)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304501Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305606Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307165Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2307166Protein automated matches [190154] (78 species)
    not a true protein
  7. 3064658Species Saccharomyces cerevisiae [TaxId:4932] [364720] (1 PDB entry)
  8. 3064670Domain d2xaub3: 2xau B:455-520 [364732]
    Other proteins in same PDB: d2xaua1, d2xaua2, d2xaua4, d2xaua5, d2xaub1, d2xaub2, d2xaub4, d2xaub5
    automated match to d3kx2a3
    protein/RNA complex; complexed with act, adp, gol, mg, ni

Details for d2xaub3

PDB Entry: 2xau (more details), 1.9 Å

PDB Description: crystal structure of the prp43p deah-box rna helicase in complex with adp
PDB Compounds: (B:) Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP43

SCOPe Domain Sequences for d2xaub3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xaub3 a.4.5.0 (B:455-520) automated matches {Saccharomyces cerevisiae [TaxId: 4932]}
peilrsnlsstvlelkklgiddlvhfdfmdppapetmmraleelnylaclddegnltplg
rlasqf

SCOPe Domain Coordinates for d2xaub3:

Click to download the PDB-style file with coordinates for d2xaub3.
(The format of our PDB-style files is described here.)

Timeline for d2xaub3:

  • d2xaub3 appears in periodic updates to SCOPe 2.07 starting on 2019-02-11