SCOPe 2.08: Domain d5za3a_: 5za3 A:

Lineage for d5za3a_ (5za3 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families)
   binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family

5. Family a.4.6.0: automated matches [191513] (1 protein)
   not a true family

6. Protein automated matches [190858] (25 species)
   not a true protein

7. Species Streptococcus mutans [TaxId:1309] [364726] (1 PDB entry)

8. Domain d5za3a_: 5za3 A: [364728]
   automated match to d2zxja_

Details for d5za3a_

PDB Entry: 5za3, 1.5 Å

PDB Description: structure of a c-terminal s. mutans response regulator vicr domain

PDB Compounds: (A:) DNA-binding response regulator

SCOPe Domain Sequences for d5za3a_:

Sequence; same for both SEQRES and ATOM records:

>d5za3a_ a.4.6.0 (A:) automated matches {Streptococcus mutans [TaxId: 1309]}
peiiigdlqilpdafvakkrgtevelthrefellhhlathtgqvmtrehlletvwgydyf
gdvrtvdvtvrrlrekiedtpsrpeyiltrrgvgyymksyd

Timeline for d5za3a_:

• d5za3a_ first appeared in SCOPe 2.07