Lineage for d2xaua4 (2xau A:521-634)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2344349Fold a.289: Sec63 N-terminal domain-like [158701] (1 superfamily)
    multihelical; consists of two helical subdomains
  4. 2344350Superfamily a.289.1: Sec63 N-terminal domain-like [158702] (4 families) (S)
  5. Family a.289.1.0: automated matches [254268] (1 protein)
    not a true family
  6. Protein automated matches [254621] (2 species)
    not a true protein
  7. 3064660Species Saccharomyces cerevisiae [TaxId:4932] [364722] (1 PDB entry)
  8. 3064661Domain d2xaua4: 2xau A:521-634 [364723]
    Other proteins in same PDB: d2xaua1, d2xaua2, d2xaua3, d2xaua5, d2xaub1, d2xaub2, d2xaub3, d2xaub5
    automated match to d3kx2a4
    protein/RNA complex; complexed with act, adp, gol, mg, ni

Details for d2xaua4

PDB Entry: 2xau (more details), 1.9 Å

PDB Description: crystal structure of the prp43p deah-box rna helicase in complex with adp
PDB Compounds: (A:) Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP43

SCOPe Domain Sequences for d2xaua4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xaua4 a.289.1.0 (A:521-634) automated matches {Saccharomyces cerevisiae [TaxId: 4932]}
pldpmlavmligsfefqcsqeiltivamlsvpnvfirptkdkkraddaknifahpdgdhi
tllnvyhafksdeayeygihkwcrdhylnyrslsaadnirsqlerlmnrynlel

SCOPe Domain Coordinates for d2xaua4:

Click to download the PDB-style file with coordinates for d2xaua4.
(The format of our PDB-style files is described here.)

Timeline for d2xaua4:

  • d2xaua4 appears in periodic updates to SCOPe 2.07 starting on 2019-02-11