Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (158 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225477] (15 PDB entries) |
Domain d2xaua1: 2xau A:3-270 [364718] Other proteins in same PDB: d2xaua3, d2xaua4, d2xaua5, d2xaub3, d2xaub4, d2xaub5 automated match to d5jpta1 protein/RNA complex; complexed with act, adp, gol, mg, ni |
PDB Entry: 2xau (more details), 1.9 Å
SCOPe Domain Sequences for d2xaua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xaua1 c.37.1.0 (A:3-270) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} skrrfssehpdpvetsipeqaaeiaeelskqhplpseeplvhhdagefkglqrhhtsaee aqkledgkinpftgreftpkyvdilkirrelpvhaqrdeflklyqnnqimvfvgetgsgk ttqipqfvlfdemphlentqvactqprrvaamsvaqrvaeemdvklgeevgysirfenkt snktilkymtdgmllreamedhdlsrysciildeahertlatdilmgllkqvvkrrpdlk iiimsatldaekfqryfndapllavpgr
Timeline for d2xaua1: