Lineage for d2xaua1 (2xau A:3-270)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2451887Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2451888Protein automated matches [190123] (144 species)
    not a true protein
  7. 2451985Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225477] (13 PDB entries)
  8. 3064656Domain d2xaua1: 2xau A:3-270 [364718]
    Other proteins in same PDB: d2xaua3, d2xaua4, d2xaua5, d2xaub3, d2xaub4, d2xaub5
    automated match to d5jpta1
    protein/RNA complex; complexed with act, adp, gol, mg, ni

Details for d2xaua1

PDB Entry: 2xau (more details), 1.9 Å

PDB Description: crystal structure of the prp43p deah-box rna helicase in complex with adp
PDB Compounds: (A:) Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP43

SCOPe Domain Sequences for d2xaua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xaua1 c.37.1.0 (A:3-270) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
skrrfssehpdpvetsipeqaaeiaeelskqhplpseeplvhhdagefkglqrhhtsaee
aqkledgkinpftgreftpkyvdilkirrelpvhaqrdeflklyqnnqimvfvgetgsgk
ttqipqfvlfdemphlentqvactqprrvaamsvaqrvaeemdvklgeevgysirfenkt
snktilkymtdgmllreamedhdlsrysciildeahertlatdilmgllkqvvkrrpdlk
iiimsatldaekfqryfndapllavpgr

SCOPe Domain Coordinates for d2xaua1:

Click to download the PDB-style file with coordinates for d2xaua1.
(The format of our PDB-style files is described here.)

Timeline for d2xaua1:

  • d2xaua1 appears in periodic updates to SCOPe 2.07 starting on 2019-02-11