Lineage for d6isua_ (6isu A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2497139Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2497140Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2497753Family d.3.1.6: Ubiquitin carboxyl-terminal hydrolase UCH-L [54050] (3 proteins)
    automatically mapped to Pfam PF01088
  6. 2497762Protein Ubiquitin carboxyl-terminal hydrolase UCH-l3 [54051] (2 species)
  7. 2497763Species Human (Homo sapiens) [TaxId:9606] [54052] (3 PDB entries)
    Uniprot P15374
  8. 3064651Domain d6isua_: 6isu A: [364713]
    Other proteins in same PDB: d6isub_, d6isuc_
    automated match to d1xd3a_

Details for d6isua_

PDB Entry: 6isu (more details), 1.87 Å

PDB Description: crystal structure of lys27-linked di-ubiquitin in complex with its selective interacting protein uchl3
PDB Compounds: (A:) Ubiquitin carboxyl-terminal hydrolase isozyme L3

SCOPe Domain Sequences for d6isua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6isua_ d.3.1.6 (A:) Ubiquitin carboxyl-terminal hydrolase UCH-l3 {Human (Homo sapiens) [TaxId: 9606]}
qrwlpleanpevtnqflkqlglhpnwqfvdvygmdpellsmvprpvcavlllfpitekye
vfrteeeekiksqgqdvtssvyfmkqtisnacgtiglihaiannkdkmhfesgstlkkfl
eesvsmspeerarylenydairvthetsahegqteapsidekvdlhfialvhvdghlyel
dgrkpfpinhgetsdetlledaievckkfmerdpdelrfnaialsaa

SCOPe Domain Coordinates for d6isua_:

Click to download the PDB-style file with coordinates for d6isua_.
(The format of our PDB-style files is described here.)

Timeline for d6isua_:

  • d6isua_ is new in SCOPe 2.07-stable