Lineage for d6ihda2 (6ihd A:142-306)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2556795Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2556796Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2557402Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 2557403Protein automated matches [226850] (36 species)
    not a true protein
  7. 3064458Species Metallosphaera sedula [TaxId:43687] [364520] (2 PDB entries)
  8. 3064646Domain d6ihda2: 6ihd A:142-306 [364708]
    Other proteins in same PDB: d6ihda1, d6ihdb1
    automated match to d3czma2
    complexed with etx, nad

Details for d6ihda2

PDB Entry: 6ihd (more details), 2.3 Å

PDB Description: crystal strcuture of malate dehydrogenase from metallosphaera sedula
PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d6ihda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ihda2 d.162.1.0 (A:142-306) automated matches {Metallosphaera sedula [TaxId: 43687]}
dqvetmrmrsfiakklkipvtsvdgfvggehgedavvlwstvkikgkpvdefninkdevs
dyvkkipgeiirviggttwgpgtiiadiiksiafsenrvmsiatpkeyekeiihvsaptv
vgssigpsleslldekdrwhlnsamkdfyeaykenlkqleqatka

SCOPe Domain Coordinates for d6ihda2:

Click to download the PDB-style file with coordinates for d6ihda2.
(The format of our PDB-style files is described here.)

Timeline for d6ihda2:

  • d6ihda2 appears in periodic updates to SCOPe 2.07 starting on 2019-02-11

View in 3D
Domains from same chain:
(mouse over for more information)
d6ihda1