Lineage for d6j5fa_ (6j5f A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2361840Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2362784Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2362785Protein automated matches [190226] (64 species)
    not a true protein
  7. 3064620Species Tick-borne encephalitis virus [TaxId:11084] [364682] (1 PDB entry)
  8. 3064621Domain d6j5fa_: 6j5f A: [364683]
    Other proteins in same PDB: d6j5fh1, d6j5fh2, d6j5fl_
    automated match to d1s6na_

Details for d6j5fa_

PDB Entry: 6j5f (more details), 1.8 Å

PDB Description: complex structure of mab 4.2-scfv with tick-borne encephalitis virus envelope protein domain iii
PDB Compounds: (A:) envelope protein

SCOPe Domain Sequences for d6j5fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6j5fa_ b.1.18.0 (A:) automated matches {Tick-borne encephalitis virus [TaxId: 11084]}
ytmcdktkftwkraptdsghdtvvmevtfsgtkpcripvravahgspdvnvamlitpnpt
ienngggfiemqlppgdniiyvgelshqwfqkgs

SCOPe Domain Coordinates for d6j5fa_:

Click to download the PDB-style file with coordinates for d6j5fa_.
(The format of our PDB-style files is described here.)

Timeline for d6j5fa_:

  • d6j5fa_ appears in periodic updates to SCOPe 2.07 starting on 2019-02-11