Lineage for d1b7na_ (1b7n A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 850027Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 850028Superfamily d.2.1: Lysozyme-like [53955] (11 families) (S)
  5. 850037Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 850101Protein Lysozyme [53961] (14 species)
    ubiquitous in a variety of tissues and secretions
  7. 850425Species Human (Homo sapiens) [TaxId:9606] [53969] (205 PDB entries)
    Uniprot P00695
  8. 850505Domain d1b7na_: 1b7n A: [36468]
    complexed with na; mutant

Details for d1b7na_

PDB Entry: 1b7n (more details), 1.8 Å

PDB Description: verification of spmp using mutant human lysozymes
PDB Compounds: (A:) protein (lysozyme)

SCOP Domain Sequences for d1b7na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b7na_ d.2.1.2 (A:) Lysozyme {Human (Homo sapiens) [TaxId: 9606]}
kvfercelartlkrlgmdgyrgislanwmclakwlsgyntratnynagdrstdygifqin
srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcgv

SCOP Domain Coordinates for d1b7na_:

Click to download the PDB-style file with coordinates for d1b7na_.
(The format of our PDB-style files is described here.)

Timeline for d1b7na_: