SCOPe 2.08: Domain d6mfqb2: 6mfq B:232-365

Lineage for d6mfqb2 (6mfq B:232-365)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.0: automated matches [191504] (1 protein)
   not a true family

6. Protein automated matches [190826] (23 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189350] (13 PDB entries)

8. Domain d6mfqb2: 6mfq B:232-365 [364670]
   Other proteins in same PDB: d6mfqa1, d6mfqb1
   automated match to d1ea6a1

Details for d6mfqb2

PDB Entry: 6mfq, 2.6 Å

PDB Description: crystal structure of a pms2 variant

PDB Compounds: (B:) mismatch repair endonuclease pms2

SCOPe Domain Sequences for d6mfqb2:

Sequence, based on SEQRES records:

>d6mfqb2 d.14.1.0 (B:232-365) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gqkqlqslipfvqlppsdsvceeyglscsdalhnlfyisgfisqcthgvgrsstdrqfff
inrrpcdpakvcrlvnevyhmynrhqypfvvlnisvdsecvdinvtpdkrqillqeekll
lavlktsligmfds

Sequence, based on observed residues (ATOM records):

>d6mfqb2 d.14.1.0 (B:232-365) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gqkqlqslipfvqlppsdsvceeyglscsdalhnlfyisgfisqcthgvgrsstdrqfff
inrrpcdpakvcrlvnevyhmynrhqypfvvlnisvdsecvdqillqeeklllavlktsl
igmfds

Timeline for d6mfqb2:

• d6mfqb2 first appeared in SCOPe 2.07