Lineage for d1ckda_ (1ckd A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 405476Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 405477Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 405486Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 405538Protein Lysozyme [53961] (14 species)
    ubiquitous in a variety of tissues and secretions
  7. 405763Species Human (Homo sapiens) [TaxId:9606] [53969] (203 PDB entries)
  8. 405810Domain d1ckda_: 1ckd A: [36467]
    complexed with na; mutant

Details for d1ckda_

PDB Entry: 1ckd (more details), 1.8 Å

PDB Description: t43v mutant human lysozyme

SCOP Domain Sequences for d1ckda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ckda_ d.2.1.2 (A:) Lysozyme {Human (Homo sapiens)}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntravnynagdrstdygifqin
srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcgv

SCOP Domain Coordinates for d1ckda_:

Click to download the PDB-style file with coordinates for d1ckda_.
(The format of our PDB-style files is described here.)

Timeline for d1ckda_: