Lineage for d6mfqb1 (6mfq B:33-231)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2973214Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2973215Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2973765Family d.122.1.2: DNA gyrase/MutL, N-terminal domain [55879] (7 proteins)
  6. 2973823Protein automated matches [191126] (3 species)
    not a true protein
  7. 2973835Species Human (Homo sapiens) [TaxId:9606] [364656] (1 PDB entry)
  8. 2973837Domain d6mfqb1: 6mfq B:33-231 [364669]
    Other proteins in same PDB: d6mfqa2, d6mfqb2
    automated match to d1ea6a2

Details for d6mfqb1

PDB Entry: 6mfq (more details), 2.6 Å

PDB Description: crystal structure of a pms2 variant
PDB Compounds: (B:) mismatch repair endonuclease pms2

SCOPe Domain Sequences for d6mfqb1:

Sequence, based on SEQRES records: (download)

>d6mfqb1 d.122.1.2 (B:33-231) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lslstavkelvensldagatnidlklkdygvdlievsdngcgveeenfegltlkhhtski
qefadltqvetfgfrgealsslcalsdvtistchasakvgtrlmfdhngkiiqktpyprp
rgttvsvqqlfstlpvrhkefqrnikkeyakmvqvlhayciisagirvsctnqleqgkrq
pvvctggspsikenigsvf

Sequence, based on observed residues (ATOM records): (download)

>d6mfqb1 d.122.1.2 (B:33-231) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lslstavkelvensldagatnidlklkdygvdlievsdngcgveeenfegltlealsslc
alsdvtistchasakvgtrlmfdhngkiiqktpyprprgttvsvqqlfstlpvrhkefqr
nikkeyakmvqvlhayciisagirvsctnqleqgkrqpvvctggspsikenigsvf

SCOPe Domain Coordinates for d6mfqb1:

Click to download the PDB-style file with coordinates for d6mfqb1.
(The format of our PDB-style files is described here.)

Timeline for d6mfqb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6mfqb2