SCOPe 2.08: Domain d6n4bc_: 6n4b C:

Lineage for d6n4bc_ (6n4b C:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family)
   long alpha-helix interrupted in the middle
   automatically mapped to Pfam PF00631

5. Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (2 proteins)

6. Protein Transducin (heterotrimeric G protein), gamma chain [48672] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [48673] (72 PDB entries)

8. Domain d6n4bc_: 6n4b C: [364666]
   Other proteins in same PDB: d6n4bb_, d6n4br_, d6n4bs1, d6n4bs2
   automated match to d2trcg_
   complexed with clr, kca

Details for d6n4bc_

PDB Entry: 6n4b, 3 Å

PDB Description: cannabinoid receptor 1-g protein complex

PDB Compounds: (C:) Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2

SCOPe Domain Sequences for d6n4bc_:

Sequence; same for both SEQRES and ATOM records:

>d6n4bc_ a.137.3.1 (C:) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus) [TaxId: 9913]}
asiaqarklveqlkmeanidrikvskaaadlmayceahakedplltpvpasenpfre

Timeline for d6n4bc_:

• d6n4bc_ first appeared in SCOPe 2.07