SCOPe 2.08: Domain d6j9tc1: 6j9t C:3-150

Lineage for d6j9tc1 (6j9t C:3-150)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein automated matches [226881] (8 species)
   not a true protein

7. Species Lactobacillus casei [TaxId:219334] [364534] (3 PDB entries)

8. Domain d6j9tc1: 6j9t C:3-150 [364654]
   Other proteins in same PDB: d6j9ta2, d6j9tb2, d6j9tc2, d6j9td2, d6j9te2, d6j9tf2
   automated match to d1llca1
   complexed with fbp, so4

Details for d6j9tc1

PDB Entry: 6j9t, 2.7 Å

PDB Description: complex structure of lactobacillus casei lactate dehydrogenase with fructose-1,6-bisphosphate

PDB Compounds: (C:) l-lactate dehydrogenase

SCOPe Domain Sequences for d6j9tc1:

Sequence, based on SEQRES records:

>d6j9tc1 c.2.1.5 (C:3-150) automated matches {Lactobacillus casei [TaxId: 219334]}
sitdkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidlsnalpfts
pkkiysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngifl
vaanpvdiltyatwklsgfpknrvvgsg

Sequence, based on observed residues (ATOM records):

>d6j9tc1 c.2.1.5 (C:3-150) automated matches {Lactobacillus casei [TaxId: 219334]}
sitdkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidlsnalpfts
pkkiysaeysdakdadlvvitagapqtrldlvnknlkilksivdpivdsgfngiflvaan
pvdiltyatwklsgfpknrvvgsg

Timeline for d6j9tc1:

• d6j9tc1 first appeared in SCOPe 2.07