Lineage for d6nstf_ (6nst F:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2573070Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
    2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8
  4. 2573071Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families) (S)
  5. 2573190Family e.17.1.0: automated matches [191499] (1 protein)
    not a true family
  6. 2573191Protein automated matches [190815] (19 species)
    not a true protein
  7. 3064572Species Pseudomonas aeruginosa [TaxId:208964] [364634] (1 PDB entry)
  8. 3064580Domain d6nstf_: 6nst F: [364642]
    automated match to d3u0ga_
    complexed with so4

Details for d6nstf_

PDB Entry: 6nst (more details), 2.14 Å

PDB Description: crystal structure of branched chain amino acid aminotransferase from pseudomonas aeruginosa
PDB Compounds: (F:) branched-chain-amino-acid aminotransferase

SCOPe Domain Sequences for d6nstf_:

Sequence, based on SEQRES records: (download)

>d6nstf_ e.17.1.0 (F:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
msmadrdgviwydgelvqwrdatthvlththhygmgvfegvraydtpqgtaifrlqahtd
rlfdsahimnmqipysrdeineatraavrennlesayirpmvfygsegmglrasglkvhv
iiaawswgaymgeealqqgikvrtssftrhhvnismtraksngayinsmlalqeaisgga
deammldpegyvaegsgenifiikdgviytpevtaclngitrntiltlaaehgfklvekr
itrdevyiadeafftgtaaevtpirevdgrkigagrrgpvteklqkayfdlvsgkteaha
ewrtlvk

Sequence, based on observed residues (ATOM records): (download)

>d6nstf_ e.17.1.0 (F:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
msmadrdgviwydgelvqwrdatthvlththhygmgvfegvraydtpqgtaifrlqahtd
rlfdsahimnmqipysrdeineatraavrennlesayirpmvfygsegmglrasglkvhv
iiaawsealqqgikvrtssftrhhvnismtraksngayinsmlalqeaisggadeammld
pegyvaegsgenifiikdgviytpevtaclngitrntiltlaaehgfklvekritrdevy
iadeafftgtaaevtpirevdgrkigagrrgpvteklqkayfdlvsgkteahaewrtlvk

SCOPe Domain Coordinates for d6nstf_:

Click to download the PDB-style file with coordinates for d6nstf_.
(The format of our PDB-style files is described here.)

Timeline for d6nstf_:

  • d6nstf_ appears in periodic updates to SCOPe 2.07 starting on 2019-02-11