SCOPe 2.07: Domain d6j5dl_: 6j5d L:

Lineage for d6j5dl_ (6j5d L:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (212 PDB entries)

8. Domain d6j5dl_: 6j5d L: [364619]
   Other proteins in same PDB: d6j5da_, d6j5dh1, d6j5dh2
   automated match to d1vfaa_

Details for d6j5dl_

PDB Entry: 6j5d, 1.8 Å

PDB Description: complex structure of mab 4.2-scfv with louping ill virus envelope protein domain iii

PDB Compounds: (L:) Antibody Light Chain

SCOPe Domain Sequences for d6j5dl_:

Sequence; same for both SEQRES and ATOM records:

>d6j5dl_ b.1.1.1 (L:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dieltqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvykaqtladgvps
rfsgsgsgtqyslkinslqpedfgsyycqhfwstppwtfgggtkleik

Timeline for d6j5dl_:

• d6j5dl_ is new in SCOPe 2.07-stable
  
• d6j5dl_ appears in the current release, SCOPe 2.08