Lineage for d6j5da_ (6j5d A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2361840Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2362784Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2362785Protein automated matches [190226] (64 species)
    not a true protein
  7. 3064553Species Louping ill virus [TaxId:11086] [364615] (1 PDB entry)
  8. 3064554Domain d6j5da_: 6j5d A: [364616]
    Other proteins in same PDB: d6j5dh1, d6j5dh2, d6j5dl_
    automated match to d2jqma_

Details for d6j5da_

PDB Entry: 6j5d (more details), 1.8 Å

PDB Description: complex structure of mab 4.2-scfv with louping ill virus envelope protein domain iii
PDB Compounds: (A:) Envelope

SCOPe Domain Sequences for d6j5da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6j5da_ b.1.18.0 (A:) automated matches {Louping ill virus [TaxId: 11086]}
ytmcdkskfawkrtptdsghdtvvmevtfsgskpcripvravahgspdvnvamlitpnpt
iendgggfiemqlppgdniiyvgelshqwfqtgs

SCOPe Domain Coordinates for d6j5da_:

Click to download the PDB-style file with coordinates for d6j5da_.
(The format of our PDB-style files is described here.)

Timeline for d6j5da_:

  • d6j5da_ appears in periodic updates to SCOPe 2.07 starting on 2019-02-10