SCOPe 2.01: Domain d1lhja_: 1lhj A:

Lineage for d1lhja_ (1lhj A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.2: C-type lysozyme [53960] (3 proteins)

6. Protein Lysozyme [53961] (14 species)
   ubiquitous in a variety of tissues and secretions

7. Species Human (Homo sapiens) [TaxId:9606] [53969] (208 PDB entries)
   Uniprot P00695

8. Domain d1lhja_: 1lhj A: [36461]
   mutant

Details for d1lhja_

PDB Entry: 1lhj, 1.8 Å

PDB Description: role of proline residues in human lysozyme stability: a scanning calorimetric study combined with x-ray structure analysis of proline mutants

PDB Compounds: (A:) human lysozyme

SCOPe Domain Sequences for d1lhja_:

Sequence; same for both SEQRES and ATOM records:

>d1lhja_ d.2.1.2 (A:) Lysozyme {Human (Homo sapiens) [TaxId: 9606]}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
srywcndgktpgavnachlscsallqdniadavacakrvvrdgqgirawvawrnrcqnrd
vrqyvqgcgv

Timeline for d1lhja_:

• d1lhja_ first appeared (with stable ids) in SCOP 1.55, called d1lhj__
  
• d1lhja_ appears in SCOP 1.75
  
• d1lhja_ appears in SCOPe 2.02
  
• d1lhja_ appears in the current release, SCOPe 2.08