Lineage for d1lhj__ (1lhj -)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 497065Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 497066Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 497075Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 497127Protein Lysozyme [53961] (14 species)
    ubiquitous in a variety of tissues and secretions
  7. 497356Species Human (Homo sapiens) [TaxId:9606] [53969] (204 PDB entries)
  8. 497420Domain d1lhj__: 1lhj - [36461]

Details for d1lhj__

PDB Entry: 1lhj (more details), 1.8 Å

PDB Description: role of proline residues in human lysozyme stability: a scanning calorimetric study combined with x-ray structure analysis of proline mutants

SCOP Domain Sequences for d1lhj__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lhj__ d.2.1.2 (-) Lysozyme {Human (Homo sapiens)}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
srywcndgktpgavnachlscsallqdniadavacakrvvrdgqgirawvawrnrcqnrd
vrqyvqgcgv

SCOP Domain Coordinates for d1lhj__:

Click to download the PDB-style file with coordinates for d1lhj__.
(The format of our PDB-style files is described here.)

Timeline for d1lhj__: