Lineage for d6j5dh1 (6j5d H:9-120)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (25 species)
    not a true protein
  7. 2357727Species Mouse (Mus musculus) [TaxId:10090] [188198] (670 PDB entries)
  8. 3064543Domain d6j5dh1: 6j5d H:9-120 [364605]
    Other proteins in same PDB: d6j5da_, d6j5dh2, d6j5dl_
    automated match to d5i0za_

Details for d6j5dh1

PDB Entry: 6j5d (more details), 1.8 Å

PDB Description: complex structure of mab 4.2-scfv with louping ill virus envelope protein domain iii
PDB Compounds: (H:) antibody heavy chain

SCOPe Domain Sequences for d6j5dh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6j5dh1 b.1.1.0 (H:9-120) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
pelvkpgasvkmsckasgytftdyvigwvkqrtgqglewigeiypgsgttyynekfkdka
tltadkssntaymqlssltsedsavyfcargedgyyialdywgqgttvtvss

SCOPe Domain Coordinates for d6j5dh1:

Click to download the PDB-style file with coordinates for d6j5dh1.
(The format of our PDB-style files is described here.)

Timeline for d6j5dh1:

  • d6j5dh1 appears in periodic updates to SCOPe 2.07 starting on 2019-02-10

View in 3D
Domains from same chain:
(mouse over for more information)
d6j5dh2