Lineage for d6j9ua1 (6j9u A:4-150)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2844315Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 2844864Protein automated matches [226881] (8 species)
    not a true protein
  7. 2844911Species Lactobacillus casei [TaxId:219334] [364534] (3 PDB entries)
  8. 2844924Domain d6j9ua1: 6j9u A:4-150 [364595]
    Other proteins in same PDB: d6j9ua2, d6j9ub2, d6j9uc2, d6j9ud2, d6j9ue2, d6j9uf2
    automated match to d1llca1
    complexed with pyr, so4; mutant

Details for d6j9ua1

PDB Entry: 6j9u (more details), 2.79 Å

PDB Description: complex structure of lactobacillus casei lactate dehydrogenase penta mutant with pyruvate
PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d6j9ua1:

Sequence, based on SEQRES records: (download)

>d6j9ua1 c.2.1.5 (A:4-150) automated matches {Lactobacillus casei [TaxId: 219334]}
itdkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidledalpftsp
kkiysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngiflv
aanpvdiltyatwklsgfpknrvvgsg

Sequence, based on observed residues (ATOM records): (download)

>d6j9ua1 c.2.1.5 (A:4-150) automated matches {Lactobacillus casei [TaxId: 219334]}
itdkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidledalpftsp
kkiysaeysdakdadlvvitagaptrldlvnknlkilksivdpivdsgfngiflvaanpv
diltyatwklsgfpknrvvgsg

SCOPe Domain Coordinates for d6j9ua1:

Click to download the PDB-style file with coordinates for d6j9ua1.
(The format of our PDB-style files is described here.)

Timeline for d6j9ua1: