Lineage for d6j9ud2 (6j9u D:151-317)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2556795Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2556796Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2556797Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2557171Protein automated matches [226882] (9 species)
    not a true protein
  7. 3064474Species Lactobacillus casei [TaxId:219334] [364536] (3 PDB entries)
  8. 3064504Domain d6j9ud2: 6j9u D:151-317 [364566]
    Other proteins in same PDB: d6j9ua1, d6j9ub1, d6j9uc1, d6j9ud1, d6j9ue1, d6j9uf1
    automated match to d1llca2
    complexed with pyr, so4; mutant

Details for d6j9ud2

PDB Entry: 6j9u (more details), 2.79 Å

PDB Description: complex structure of lactobacillus casei lactate dehydrogenase penta mutant with pyruvate
PDB Compounds: (D:) l-lactate dehydrogenase

SCOPe Domain Sequences for d6j9ud2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6j9ud2 d.162.1.1 (D:151-317) automated matches {Lactobacillus casei [TaxId: 219334]}
tsldtarfrqsiakmvnvdarsvhayimgehgdtefpvwshaniggvtiaewvkahpeik
edklvkmfedvrnkayeiiklkgatfygiatalariskailndenavlplsvymdgqygl
ndiyigtpavinrngiqnileipltdheeesmqksasqlkkvltdaf

SCOPe Domain Coordinates for d6j9ud2:

Click to download the PDB-style file with coordinates for d6j9ud2.
(The format of our PDB-style files is described here.)

Timeline for d6j9ud2:

  • d6j9ud2 appears in periodic updates to SCOPe 2.07 starting on 2019-02-11