Lineage for d6h1ya_ (6h1y A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2455315Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2455316Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2455317Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 2455383Protein Thioredoxin [52835] (16 species)
  7. 2455405Species Escherichia coli [TaxId:562] [52836] (54 PDB entries)
    Uniprot P00274 ! Uniprot P00581
  8. 3064491Domain d6h1ya_: 6h1y A: [364553]
    automated match to d2trxa_

Details for d6h1ya_

PDB Entry: 6h1y (more details), 2.99 Å

PDB Description: crystal structure of a chimeric variant of thioredoxin from escherichia coli
PDB Compounds: (A:) Thioredoxin 1,Thioredoxin (TrxA-1),Thioredoxin 1

SCOPe Domain Sequences for d6h1ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h1ya_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]}
sdkiihltddsfdevirnnklilvdfwaewcgpckmiapildeiadeyqgkltvaklnid
qnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla

SCOPe Domain Coordinates for d6h1ya_:

Click to download the PDB-style file with coordinates for d6h1ya_.
(The format of our PDB-style files is described here.)

Timeline for d6h1ya_:

  • d6h1ya_ appears in periodic updates to SCOPe 2.07 starting on 2019-02-10

View in 3D
Domains from other chains:
(mouse over for more information)
d6h1yb_