SCOPe 2.04: Domain d1b5ua_: 1b5u A:

Lineage for d1b5ua_ (1b5u A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
   automatically mapped to Pfam PF00062

6. Protein Lysozyme [53961] (14 species)
   ubiquitous in a variety of tissues and secretions

7. Species Human (Homo sapiens) [TaxId:9606] [53969] (201 PDB entries)
   Uniprot P00695

8. Domain d1b5ua_: 1b5u A: [36453]
   complexed with na; mutant

Details for d1b5ua_

PDB Entry: 1b5u, 1.8 Å

PDB Description: contribution of hydrogen bonds to the conformational stability of human lysozyme: calorimetry and x-ray analysis of six ser->ala mutant

PDB Compounds: (A:) protein (lysozyme)

SCOPe Domain Sequences for d1b5ua_:

Sequence; same for both SEQRES and ATOM records:

>d1b5ua_ d.2.1.2 (A:) Lysozyme {Human (Homo sapiens) [TaxId: 9606]}
kvfercelartlkrlgmdgyrgialanwmclakwesgyntratnynagdrstdygifqin
srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcgv

Timeline for d1b5ua_:

• d1b5ua_ first appeared (with stable ids) in SCOP 1.55
  
• d1b5ua_ appears in SCOPe 2.03
  
• d1b5ua_ appears in SCOPe 2.05
  
• d1b5ua_ appears in the current release, SCOPe 2.08