Lineage for d6ihdb1 (6ihd B:2-141)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2426096Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2426097Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2430344Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2430345Protein automated matches [190069] (259 species)
    not a true protein
  7. 3064456Species Metallosphaera sedula [TaxId:43687] [364518] (2 PDB entries)
  8. 3064457Domain d6ihdb1: 6ihd B:2-141 [364519]
    Other proteins in same PDB: d6ihda2, d6ihdb2
    automated match to d3czma1
    complexed with etx, nad

Details for d6ihdb1

PDB Entry: 6ihd (more details), 2.3 Å

PDB Description: crystal strcuture of malate dehydrogenase from metallosphaera sedula
PDB Compounds: (B:) malate dehydrogenase

SCOPe Domain Sequences for d6ihdb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ihdb1 c.2.1.0 (B:2-141) automated matches {Metallosphaera sedula [TaxId: 43687]}
akvgfigagkigqtiaysalvsgavdeaviydiipelpdkfehelrhafatkgikanvlg
tnslddvsgmdivvisagkprkpgmsrrdlfvdnakimidlaqklpsknpgaiylmvanp
vdmmasvfmkyskqftisag

SCOPe Domain Coordinates for d6ihdb1:

Click to download the PDB-style file with coordinates for d6ihdb1.
(The format of our PDB-style files is described here.)

Timeline for d6ihdb1:

  • d6ihdb1 appears in periodic updates to SCOPe 2.07 starting on 2019-02-10

View in 3D
Domains from same chain:
(mouse over for more information)
d6ihdb2