SCOPe 2.08: Domain d6gqwe1: 6gqw E:1-167

Lineage for d6gqwe1 (6gqw E:1-167)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (37 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (291 PDB entries)

8. Domain d6gqwe1: 6gqw E:1-167 [364486]
   Other proteins in same PDB: d6gqwa2, d6gqwb2, d6gqwc2, d6gqwd2, d6gqwe2, d6gqwf2
   automated match to d3gfta_
   complexed with f8t, gnp, mg

Details for d6gqwe1

PDB Entry: 6gqw, 2.8 Å

PDB Description: kras-169 q61h gppnhp + ch-1

PDB Compounds: (E:) GTPase KRas

SCOPe Domain Sequences for d6gqwe1:

Sequence, based on SEQRES records:

>d6gqwe1 c.37.1.8 (E:1-167) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgaggvgksalviqliqnhfvdeydptiedsyrkqvvidgetclldildtag
heeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdl
psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhk

Sequence, based on observed residues (ATOM records):

>d6gqwe1 c.37.1.8 (E:1-167) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgaggvgksalviqliqnhfvdeydpedsyrkqvvidgetclldildtagrd
qymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdlpsrtvdtkq
aqdlarsygipfietsaktrqgvddafytlvreirkhk

Timeline for d6gqwe1:

• d6gqwe1 first appeared in SCOPe 2.07