Lineage for d1gfaa_ (1gfa A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 76064Fold d.2: Lysozyme-like [53954] (1 superfamily)
  4. 76065Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 76074Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 76107Protein Lysozyme [53961] (14 species)
  7. 76282Species Human (Homo sapiens) [TaxId:9606] [53969] (174 PDB entries)
  8. 76313Domain d1gfaa_: 1gfa A: [36448]

Details for d1gfaa_

PDB Entry: 1gfa (more details), 1.8 Å

PDB Description: crystal structure of mutant human lysozyme substituted at the surface positions

SCOP Domain Sequences for d1gfaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gfaa_ d.2.1.2 (A:) Lysozyme {Human (Homo sapiens)}
kdfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcgv

SCOP Domain Coordinates for d1gfaa_:

Click to download the PDB-style file with coordinates for d1gfaa_.
(The format of our PDB-style files is described here.)

Timeline for d1gfaa_: