Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (7 families) |
Family d.2.1.2: C-type lysozyme [53960] (2 proteins) |
Protein Lysozyme [53961] (16 species) ubiquitous in a variety of tussues ans secretions |
Species Human (Homo sapiens) [TaxId:9606] [53969] (200 PDB entries) |
Domain d2hef__: 2hef - [36446] complexed with na; mutant |
PDB Entry: 2hef (more details), 1.8 Å
SCOP Domain Sequences for d2hef__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hef__ d.2.1.2 (-) Lysozyme {Human (Homo sapiens)} kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin srywcndgktpgavnachlscsallqdnaadavacakrvvrdpqgirawvawrnrcqnrd vrqyvqgcgv
Timeline for d2hef__: