Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.12: TrpR-like [48295] (4 families) contains an extra shared helix after the HTH motif |
Family a.4.12.1: Trp repressor, TrpR [48296] (2 proteins) intertwined dimer of identical 6-helical subunits automatically mapped to Pfam PF01371 |
Protein automated matches [254650] (4 species) not a true protein |
Species Escherichia coli [TaxId:83334] [340663] (7 PDB entries) |
Domain d6ejwd_: 6ejw D: [364428] automated match to d5tm0a_ complexed with iac |
PDB Entry: 6ejw (more details), 1.99 Å
SCOPe Domain Sequences for d6ejwd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ejwd_ a.4.12.1 (D:) automated matches {Escherichia coli [TaxId: 83334]} spysaamaeqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvriveellrg emsqrelknelgagiatitrgsnslkaapvelrqwleevll
Timeline for d6ejwd_: