Lineage for d6ejza_ (6ejz A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2695732Superfamily a.4.12: TrpR-like [48295] (4 families) (S)
    contains an extra shared helix after the HTH motif
  5. 2695733Family a.4.12.1: Trp repressor, TrpR [48296] (2 proteins)
    intertwined dimer of identical 6-helical subunits
    automatically mapped to Pfam PF01371
  6. 2695778Protein automated matches [254650] (4 species)
    not a true protein
  7. 2695783Species Escherichia coli [TaxId:585055] [364391] (1 PDB entry)
  8. 2695784Domain d6ejza_: 6ejz A: [364424]
    automated match to d5tm0a_
    complexed with edo, iac, so4

Details for d6ejza_

PDB Entry: 6ejz (more details), 1.9 Å

PDB Description: tryptophan repressor trpr from e.coli variant s88y with indole-3- acetic acid as ligand
PDB Compounds: (A:) trp operon repressor

SCOPe Domain Sequences for d6ejza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ejza_ a.4.12.1 (A:) automated matches {Escherichia coli [TaxId: 585055]}
qspysaamaeqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvriveellr
gemsqrelknelgagiatitrgsnylkaapvelrqwleevllk

SCOPe Domain Coordinates for d6ejza_:

Click to download the PDB-style file with coordinates for d6ejza_.
(The format of our PDB-style files is described here.)

Timeline for d6ejza_: