SCOP 1.63: Domain d1lz6__: 1lz6 -

Lineage for d1lz6__ (1lz6 -)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (7 families)

5. Family d.2.1.2: C-type lysozyme [53960] (2 proteins)

6. Protein Lysozyme [53961] (16 species)
   ubiquitous in a variety of tussues ans secretions

7. Species Human (Homo sapiens) [TaxId:9606] [53969] (200 PDB entries)

8. Domain d1lz6__: 1lz6 - [36442]
   complexed with cl; mutant

Details for d1lz6__

PDB Entry: 1lz6, 1.8 Å

PDB Description: structural and functional analyses of the arg-gly-asp sequence introduced into human lysozyme

SCOP Domain Sequences for d1lz6__:

Sequence; same for both SEQRES and ATOM records:

>d1lz6__ d.2.1.2 (-) Lysozyme {Human (Homo sapiens)}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
srywcndgktpgavtgrgdspanachlscsallqdniadavacakrvvrdpqgirawvaw
rnrcqnrdvrqyvqgcgv

Timeline for d1lz6__:

• d1lz6__ first appeared (with stable ids) in SCOP 1.55
  
• d1lz6__ appears in SCOP 1.61
  
• d1lz6__ appears in SCOP 1.65
  
• d1lz6__ appears in the current release, SCOPe 2.08, called d1lz6a_