SCOPe 2.08: Domain d6cbvl2: 6cbv L:110-214

Lineage for d6cbvl2 (6cbv L:110-214)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d6cbvl2: 6cbv L:110-214 [364410]
   Other proteins in same PDB: d6cbvb_, d6cbvh_, d6cbvl1
   automated match to d4jg1l2
   complexed with fmt, gol, na

Details for d6cbvl2

PDB Entry: 6cbv, 1.87 Å

PDB Description: crystal structure of bril bound to an affinity matured synthetic antibody.

PDB Compounds: (L:) Light Chain, Fab fragment

SCOPe Domain Sequences for d6cbvl2:

Sequence; same for both SEQRES and ATOM records:

>d6cbvl2 b.1.1.2 (L:110-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdsqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

Timeline for d6cbvl2:

• d6cbvl2 first appeared in SCOPe 2.07