SCOP 1.63: Domain d1lhm__: 1lhm -

Lineage for d1lhm__ (1lhm -)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (7 families)

5. Family d.2.1.2: C-type lysozyme [53960] (2 proteins)

6. Protein Lysozyme [53961] (16 species)
   ubiquitous in a variety of tussues ans secretions

7. Species Human (Homo sapiens) [TaxId:9606] [53969] (200 PDB entries)

8. Domain d1lhm__: 1lhm - [36441]
   mutant

Details for d1lhm__

PDB Entry: 1lhm, 1.8 Å

PDB Description: the crystal structure of a mutant lysozyme c77(slash)95a with increased secretion efficiency in yeast

SCOP Domain Sequences for d1lhm__:

Sequence; same for both SEQRES and ATOM records:

>d1lhm__ d.2.1.2 (-) Lysozyme {Human (Homo sapiens)}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
srywcndgktpgavnaahlscsallqdniadavaaakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcgv

Timeline for d1lhm__:

• d1lhm__ first appeared (with stable ids) in SCOP 1.55
  
• d1lhm__ appears in SCOP 1.61
  
• d1lhm__ appears in SCOP 1.65
  
• d1lhm__ appears in the current release, SCOPe 2.08, called d1lhma_