Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.26: ICP-like [141066] (2 families) topological variant with similarity to the Cupredoxin-like fold (49502) in the N-terminal region |
Family b.1.26.0: automated matches [191408] (1 protein) not a true family |
Protein automated matches [190560] (2 species) not a true protein |
Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [364376] (1 PDB entry) |
Domain d6cjza1: 6cjz A:4-105 [364377] Other proteins in same PDB: d6cjza2 automated match to d2c34a1 |
PDB Entry: 6cjz (more details)
SCOPe Domain Sequences for d6cjza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6cjza1 b.1.26.0 (A:4-105) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} msltednnnttitiakgenkeiilhgnpttgyswvvdsseglsntveyvadqhapgisgs ggkyhikitgtqtgegkivlvyrrpwapnandrtftlkvnvq
Timeline for d6cjza1: