SCOPe 2.08: Domain d6bx8b_: 6bx8 B:

Lineage for d6bx8b_ (6bx8 B:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.8: BPTI-like [57361] (1 superfamily)
   disulfide-rich alpha+beta fold

4. Superfamily g.8.1: BPTI-like [57362] (4 families)

5. Family g.8.1.0: automated matches [191505] (1 protein)
   not a true family

6. Protein automated matches [190829] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188132] (10 PDB entries)

8. Domain d6bx8b_: 6bx8 B: [364366]
   Other proteins in same PDB: d6bx8a_, d6bx8c_, d6bx8e_, d6bx8g_
   automated match to d1dena_
   complexed with so4

Details for d6bx8b_

PDB Entry: 6bx8, 1.98 Å

PDB Description: human mesotrypsin (prss3) complexed with tissue factor pathway inhibitor variant (tfpi1-kd1-k15r-i17c-i34c)

PDB Compounds: (B:) tissue factor pathway inhibitor

SCOPe Domain Sequences for d6bx8b_:

Sequence; same for both SEQRES and ATOM records:

>d6bx8b_ g.8.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mhsfcafkaddgpcracmkrfffniftrqceefcyggcegnqnrfesleeckkmc

Timeline for d6bx8b_:

• d6bx8b_ first appeared in SCOPe 2.07