![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
![]() | Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) ![]() |
![]() | Family b.121.4.0: automated matches [191569] (1 protein) not a true family |
![]() | Protein automated matches [190988] (21 species) not a true protein |
![]() | Species Seneca valley virus [TaxId:390157] [188689] (3 PDB entries) |
![]() | Domain d6adma_: 6adm A: [364358] Other proteins in same PDB: d6admr1, d6admr2 automated match to d3cjia_ complexed with mg |
PDB Entry: 6adm (more details), 2.84 Å
SCOPe Domain Sequences for d6adma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6adma_ b.121.4.0 (A:) automated matches {Seneca valley virus [TaxId: 390157]} stdnaetgvieagntdtdfsgelaapgsnhtnvkflfdrsrllnvikvlekdavfprpfp tqegaqqddgyfclltprptvasrpatrfglyanpsgsgvlantsldfnfyslacftyfr sdlevtvvslepdlefavgwfpsgseyqassfvydqlhvpfhftgrtprafaskggkvsf vlpwnsvssvlpvrwggasklssatrglpahadwgtiyafvprpnekkstavkhvavyir yknarawcpsmlpfrsyk
Timeline for d6adma_: