Lineage for d6n4fb_ (6n4f B:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2645405Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2645406Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2645931Protein automated matches [254646] (36 species)
    not a true protein
  7. 2646366Species Unidentified influenza virus [TaxId:11309] [364281] (1 PDB entry)
  8. 2646367Domain d6n4fb_: 6n4f B: [364345]
    Other proteins in same PDB: d6n4fa_, d6n4fc_, d6n4fe_, d6n4fg_
    automated match to d3m5jb_

Details for d6n4fb_

PDB Entry: 6n4f (more details), 3.01 Å

PDB Description: the crystal structure of hemagglutinin from a/canine/il/11613/2015 (h3n2) influenza virus.
PDB Compounds: (B:) hemagglutinin HA2

SCOPe Domain Sequences for d6n4fb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6n4fb_ h.3.1.1 (B:) automated matches {Unidentified influenza virus [TaxId: 11309]}
glfgaiagfiengwegmvdgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdleryvedtkvdlwsynaellvalenqntidltdsemnklfe
ktrrqlrenaedmgngcfkiyhkcdnaciesirngtydhniyrdeavnnrfq

SCOPe Domain Coordinates for d6n4fb_:

Click to download the PDB-style file with coordinates for d6n4fb_.
(The format of our PDB-style files is described here.)

Timeline for d6n4fb_: