Lineage for d6adsc_ (6ads C:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2409884Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2410108Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2410774Family b.121.4.0: automated matches [191569] (1 protein)
    not a true family
  6. 2410775Protein automated matches [190988] (15 species)
    not a true protein
  7. 2410849Species Seneca valley virus [TaxId:390157] [188689] (3 PDB entries)
  8. 3064282Domain d6adsc_: 6ads C: [364344]
    automated match to d3cjib_

Details for d6adsc_

PDB Entry: 6ads (more details), 2.84 Å

PDB Description: structure of seneca valley virus in acidic conditions
PDB Compounds: (C:) vp3

SCOPe Domain Sequences for d6adsc_:

Sequence, based on SEQRES records: (download)

>d6adsc_ b.121.4.0 (C:) automated matches {Seneca valley virus [TaxId: 390157]}
piptaprenslmflsttpddtvpaygnvrtppvnylpgeitdllqlariptlmafgrvda
yvpyvavptqfddkplisfpitlsdpvyqntlvgaissnfanyrgciqitltfcgpmmar
gkfllsysppngtqpqtlseamqctysiwdiglnsswtfvipyispsdyretraitnsvy
sadgwfslhkltkitlppdcpqspcilffasagedytlrlpvdcnpsyvf

Sequence, based on observed residues (ATOM records): (download)

>d6adsc_ b.121.4.0 (C:) automated matches {Seneca valley virus [TaxId: 390157]}
piptaprenslmflsttpddtvpaygnvrtppvnylpgeitdllqlariptlmafgrayv
pyvavptqfddkplisfpitlsdpvyqntlvgaissnfanyrgciqitltfcgpmmargk
fllsysppngtqpqtlseamqctysiwdiglnsswtfvipyispsdyretraitnsvysa
dgwfslhkltkitlppdcpqspcilffasagedytlrlpvdcnpsyvf

SCOPe Domain Coordinates for d6adsc_:

Click to download the PDB-style file with coordinates for d6adsc_.
(The format of our PDB-style files is described here.)

Timeline for d6adsc_:

  • d6adsc_ appears in periodic updates to SCOPe 2.07 starting on 2019-02-10

View in 3D
Domains from other chains:
(mouse over for more information)
d6adsa_