Lineage for d1lhia_ (1lhi A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 850027Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 850028Superfamily d.2.1: Lysozyme-like [53955] (11 families) (S)
  5. 850037Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 850101Protein Lysozyme [53961] (14 species)
    ubiquitous in a variety of tissues and secretions
  7. 850425Species Human (Homo sapiens) [TaxId:9606] [53969] (205 PDB entries)
    Uniprot P00695
  8. 850515Domain d1lhia_: 1lhi A: [36434]
    mutant

Details for d1lhia_

PDB Entry: 1lhi (more details), 1.8 Å

PDB Description: role of proline residues in human lysozyme stability: a scanning calorimetric study combined with x-ray structure analysis of proline mutants
PDB Compounds: (A:) human lysozyme

SCOP Domain Sequences for d1lhia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lhia_ d.2.1.2 (A:) Lysozyme {Human (Homo sapiens) [TaxId: 9606]}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
srywcndgktggavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcgv

SCOP Domain Coordinates for d1lhia_:

Click to download the PDB-style file with coordinates for d1lhia_.
(The format of our PDB-style files is described here.)

Timeline for d1lhia_: