Lineage for d6af6a2 (6af6 A:231-383)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2316812Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2317865Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 2317999Family a.29.3.0: automated matches [227204] (1 protein)
    not a true family
  6. 2318000Protein automated matches [226935] (29 species)
    not a true protein
  7. 3057097Species Serratia sp. [TaxId:104623] [357159] (5 PDB entries)
  8. 3064277Domain d6af6a2: 6af6 A:231-383 [364339]
    Other proteins in same PDB: d6af6a1
    automated match to d3mpia2
    complexed with cl, fad, gly, o4b, pro

Details for d6af6a2

PDB Entry: 6af6 (more details), 1.62 Å

PDB Description: piga with fad and proline
PDB Compounds: (A:) L-prolyl-[peptidyl-carrier protein] dehydrogenase

SCOPe Domain Sequences for d6af6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6af6a2 a.29.3.0 (A:231-383) automated matches {Serratia sp. [TaxId: 104623]}
gaggaifhdsmiwakgclsalfvgglarllettleyakarqqfgkaigqfqsvsnriidm
klrleqcrlmlyracwkhdqgqdaeadiamsklliseyavqsgldaiqtfggaamdqelg
lvrhllnmipsrifsgtndiqkeiiarklglrg

SCOPe Domain Coordinates for d6af6a2:

Click to download the PDB-style file with coordinates for d6af6a2.
(The format of our PDB-style files is described here.)

Timeline for d6af6a2:

  • d6af6a2 appears in periodic updates to SCOPe 2.07 starting on 2019-02-10

View in 3D
Domains from same chain:
(mouse over for more information)
d6af6a1